Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1
This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.
Product Specifications
Product Name Alternative
Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1
UniProt
A5IRC8
Expression Region
1-113
Origin
Staphylococcus aureus (strain JH9)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV778561 1.0 µg DNA
RPL23AP48 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details MBS6434301-01 0.1 mL
PUF60 (Poly(U)-binding-splicing Factor PUF60, 60kD poly(U)-binding-splicing Factor, FIR, VRJS, RoBPI, SIAHBP1) (MaxLight 490)
Sign In for Pricing
View Details MBS6434301-02 5x 0.1 mL
PUF60 (Poly(U)-binding-splicing Factor PUF60, 60kD poly(U)-binding-splicing Factor, FIR, VRJS, RoBPI, SIAHBP1) (MaxLight 490)
Sign In for Pricing
View Details