Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

A5IRC8

Expression Region

1-113

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Procollagen II C-Terminal Propeptide (PIICP) ELISA Kit
RDR-PIICP-Ra-01 96 Tests

Rat Procollagen II C-Terminal Propeptide (PIICP) ELISA Kit

Sign In for Pricing
View Details
Rat Procollagen II C-Terminal Propeptide (PIICP) ELISA Kit
RDR-PIICP-Ra-02 48 Tests

Rat Procollagen II C-Terminal Propeptide (PIICP) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CD117/c-kit Antibody (KIT/982) [Janelia Fluor 549]
NBP3-11446JF549 0.1 mL

Mouse Monoclonal CD117/c-kit Antibody (KIT/982) [Janelia Fluor 549]

Sign In for Pricing
View Details
Porcine G Protein Coupled Receptor 48 ELISA Kit
MBS746982-01 48 Well

Porcine G Protein Coupled Receptor 48 ELISA Kit

Sign In for Pricing
View Details
Porcine G Protein Coupled Receptor 48 ELISA Kit
MBS746982-02 96 Well

Porcine G Protein Coupled Receptor 48 ELISA Kit

Sign In for Pricing
View Details
Porcine G Protein Coupled Receptor 48 ELISA Kit
MBS746982-03 5x 96 Well

Porcine G Protein Coupled Receptor 48 ELISA Kit

Sign In for Pricing
View Details