Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

A6QFG0

Expression Region

1-113

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TYRP1 Protein, C-His
HB884011-01 50 µg

Recombinant Human TYRP1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human TYRP1 Protein, C-His
HB884011-02 100 µg

Recombinant Human TYRP1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human TYRP1 Protein, C-His
HB884011-03 1 mg

Recombinant Human TYRP1 Protein, C-His

Sign In for Pricing
View Details
Human TMEM59L knockdown cell line
ABC-KD15741 1 Vial

Human TMEM59L knockdown cell line

Sign In for Pricing
View Details
1-NAPHTHO L
N6179-10G 10 g

1-NAPHTHO L

Sign In for Pricing
View Details
Recombinant Human RELM beta
MBS7611204-01 0.05 mg

Recombinant Human RELM beta

Sign In for Pricing
View Details