Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

A6QFG0

Expression Region

1-113

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TRAT1 Antibody Picoband®, iFluor647 Conjugate
A11223-iFluor647 100 µg

Anti-TRAT1 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
TBCE (NM_001079515) Human Tagged ORF Clone Lentiviral Particle
RC214027L4V 200 µL

TBCE (NM_001079515) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human Carbonic Anhydrase-1
7-02557 5 µg

Recombinant Human Carbonic Anhydrase-1

Sign In for Pricing
View Details
Anti-PHOX2B Antibody (R2N19)
RHK88801 100 μg

Anti-PHOX2B Antibody (R2N19)

Sign In for Pricing
View Details
SLC38A5 cDNA Clone
MBS1271725-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

SLC38A5 cDNA Clone

Sign In for Pricing
View Details
SLC38A5 cDNA Clone
MBS1271725-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

SLC38A5 cDNA Clone

Sign In for Pricing
View Details