Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

A6QFG0

Expression Region

1-113

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RELT Antibody, HRP conjugated
A43244-50UG 50 µg

RELT Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 (strain EC4115/EHEC) WECG Polyclonal Antibody
MBS7171829 Inquire

Rabbit anti-Escherichia coli O157:H7 (strain EC4115/EHEC) WECG Polyclonal Antibody

Sign In for Pricing
View Details
CCR2 + CCR5 Rabbit pAb, IRDye 800CW conjugated
orb2825496 100 µL

CCR2 + CCR5 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
C-erbB-2/HER2 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated
bsm-33051M-BF555 100 µL

C-erbB-2/HER2 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Recombinant Rhesus Macaque CCL11/Eotaxin Protein
NBP2-35282-100ug 100 µg

Recombinant Rhesus Macaque CCL11/Eotaxin Protein

Sign In for Pricing
View Details
STFR E013-297x420-PE-CRD/1 AC Signs
815894 Card of 1 Pictogram(s)

STFR E013-297x420-PE-CRD/1 AC Signs

Sign In for Pricing
View Details