Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

A7X0G0

Expression Region

1-113

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A HMPA
HA110015.5G 5 g

Polystyrene A HMPA

Sign In for Pricing
View Details
IMPDH1 (NM_000883) Human Recombinant Protein
TP315206 20 µg

IMPDH1 (NM_000883) Human Recombinant Protein

Sign In for Pricing
View Details
PP11 (ENDOU) (NM_001172440) Human Over-expression Lysate
LC432923 20 µg

PP11 (ENDOU) (NM_001172440) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant FEN1 Antibody
RC-7027-01 50 μL

Recombinant FEN1 Antibody

Sign In for Pricing
View Details
Recombinant FEN1 Antibody
RC-7027-02 100 µL

Recombinant FEN1 Antibody

Sign In for Pricing
View Details
Recombinant FEN1 Antibody
RC-7027-03 1 mL

Recombinant FEN1 Antibody

Sign In for Pricing
View Details