Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

A7X0G0

Expression Region

1-113

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Streptavidin High Binding Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS
MTWSTDF4-SB75/100/W 10x 96 Well Plates

Streptavidin High Binding Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS

Sign In for Pricing
View Details
Human IgM Immunoglobulin (IM373), 0.2mg/mL
BNUB0373-500 1x 500 µL

Human IgM Immunoglobulin (IM373), 0.2mg/mL

Sign In for Pricing
View Details
PASD5 (NPAS1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C9]
TA809616AM 100 µL

PASD5 (NPAS1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C9]

Sign In for Pricing
View Details
Cell Meter™ Cell Viability Assay Kit *Red Fluorescence*
22783-AAT 200 Tests

Cell Meter™ Cell Viability Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
(1S,3R,4S,5R)-3,4,5-Trihydroxycyclohexane-1-carboxylic Acid
TRC-T888015-250MG 250 mg

(1S,3R,4S,5R)-3,4,5-Trihydroxycyclohexane-1-carboxylic Acid

Sign In for Pricing
View Details
Cystatin SN (CST1) Human Gene Knockout Kit (CRISPR)
KN202896 1 Kit

Cystatin SN (CST1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details