Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

A8Z057

Expression Region

1-113

Origin

Staphylococcus aureus (strain USA300 / TCH1516)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen II (COL2A1) Human Gene Knockout Kit (CRISPR)
KN218041LP 1 Kit

Collagen II (COL2A1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MBD5 activation kit by CRISPRa
GA110960 1 Kit

Human MBD5 activation kit by CRISPRa

Sign In for Pricing
View Details
m-Cresol Purple
TRC-C782153-1G 1 g

m-Cresol Purple

Sign In for Pricing
View Details
Tbx3 Recombinant Rabbit Monoclonal Antibody [JE33-38]
HA721184 100 µL

Tbx3 Recombinant Rabbit Monoclonal Antibody [JE33-38]

Sign In for Pricing
View Details
Human BICRA activation kit by CRISPRa
GA109369 1 Kit

Human BICRA activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant HMGCL Antibody
RC-4675-01 50 μL

Recombinant HMGCL Antibody

Sign In for Pricing
View Details