Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ML0030 (ML0030)

This Recombinant Uncharacterized protein ML0030 (ML0030) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Uncharacterized protein ML0030

UniProt

O32871

Expression Region

1-113

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIMLAAGGVVALVA VAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATSCGKNCAGCILSCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZP3 Rabbit Polyclonal Antibody (BF555)
orb2387970 100 µL

ZP3 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Cytochrome P450 1B1 (CYP1B1) discontinued
214779 50 µg

Cytochrome P450 1B1 (CYP1B1) discontinued

Sign In for Pricing
View Details
Pancreatic Lipase/PNLIP Rabbit Polyclonal Antibody (FITC)
orb2582604 100 µg

Pancreatic Lipase/PNLIP Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Anti-FLNB Polyclonal Antibody
TMAB-06071-01 50 μL

Anti-FLNB Polyclonal Antibody

Sign In for Pricing
View Details
Anti-FLNB Polyclonal Antibody
TMAB-06071-02 100 µL

Anti-FLNB Polyclonal Antibody

Sign In for Pricing
View Details
Anti-FLNB Polyclonal Antibody
TMAB-06071-03 200 µL

Anti-FLNB Polyclonal Antibody

Sign In for Pricing
View Details