Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0258 (AF_0258)
This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0258 (AF_0258) spans the amino acid sequence from region 1-113.
Product Specifications
Product Name Alternative
Uncharacterized protein AF_0258
UniProt
O29981
Expression Region
1-113
Origin
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSIEVRKSIFPSLPIIVFIVFVEVPVLSVIYPLIEVLTIYPLLISLIFSLAVFAYKFQKS EKNLKRLARQIMALFVIFWLLSQITMVVAVESEYHGIVSFRRDIYNAQLSCKG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY428747 100 µg
SPATA31D4 (NM_001145197) Human Over-expression Lysate
Sign In for Pricing
View Details 
TRC-B222465-5MG 5 mg
Benzyl 2-Acetamido-3,4-di-O-acetyl-2-deoxy-6-O-(tri-O-benzyl-L-fucopyranosyl)-Alpha-D-glucopyranoside (4:1 Alpha/Beta mixture)
Sign In for Pricing
View Details 
