Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosW (yosW)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosW (yosW) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized membrane protein yosW

UniProt

O31872

Expression Region

1-113

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMRGESNTYIKVKSVLDNSTPEDAKRNKNLIYLFTLLKGSSLIIPLAYNGLIMHENILI LCWTAFSVIYTVLSMFKVLDVLEGETVSHSRYIYLAYVFGNLIFALSIIFHIM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntrophin-2 Rabbit Polyclonal Antibody (Cy5)
orb928951 100 µL

Syntrophin-2 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
S100A7 Rabbit pAb
E2501940 100 µL

S100A7 Rabbit pAb

Sign In for Pricing
View Details
Anti-GRB7  (3C12)
YF-MA13319 100 ug

Anti-GRB7 (3C12)

Sign In for Pricing
View Details
7-[ (2-carboxypiperidin-1-yl) sulfonyl]-2,1,3-benzothiadiazol
sc-357973A 5 g

7-[ (2-carboxypiperidin-1-yl) sulfonyl]-2,1,3-benzothiadiazol

Sign In for Pricing
View Details
CD21 (CR2) Rabbit Monoclonal Antibody [Clone ID: RM372]
TA398551 100 µL

CD21 (CR2) Rabbit Monoclonal Antibody [Clone ID: RM372]

Sign In for Pricing
View Details
Anti-Angiopoietin 2 (ANGPT2)
FY-AB45099-01 1 mL

Anti-Angiopoietin 2 (ANGPT2)

Sign In for Pricing
View Details