Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosW (yosW)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosW (yosW) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized membrane protein yosW

UniProt

O31872

Expression Region

1-113

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMRGESNTYIKVKSVLDNSTPEDAKRNKNLIYLFTLLKGSSLIIPLAYNGLIMHENILI LCWTAFSVIYTVLSMFKVLDVLEGETVSHSRYIYLAYVFGNLIFALSIIFHIM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC45A1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
44206151 3x 1.0 µg DNA

SLC45A1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Recombinant Human CCNB3 Protein
E30P69440A 50 µg

Recombinant Human CCNB3 Protein

Sign In for Pricing
View Details
Prominin 2 (PROM2) Mouse Monoclonal Antibody [Clone ID: OTI3D12]
CF500349 100 µg

Prominin 2 (PROM2) Mouse Monoclonal Antibody [Clone ID: OTI3D12]

Sign In for Pricing
View Details
Mouse Monoclonal p38 delta/SAPK4 Antibody (OTI12B2) [Alexa Fluor 488]
NBP2-73188AF488 0.1 mL

Mouse Monoclonal p38 delta/SAPK4 Antibody (OTI12B2) [Alexa Fluor 488]

Sign In for Pricing
View Details
FGFR2 Recombinant Antibody
bsm-52953R 100 µL

FGFR2 Recombinant Antibody

Sign In for Pricing
View Details
FABP4 (Fatty Acid-binding Protein, Adipocyte, Adipocyte lipid-binding Protein, ALBP, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4) discontinued
360215-01 50 µL

FABP4 (Fatty Acid-binding Protein, Adipocyte, Adipocyte lipid-binding Protein, ALBP, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4) discontinued

Sign In for Pricing
View Details