Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosW (yosW)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized membrane protein yosW (yosW) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized membrane protein yosW

UniProt

O31872

Expression Region

1-113

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMRGESNTYIKVKSVLDNSTPEDAKRNKNLIYLFTLLKGSSLIIPLAYNGLIMHENILI LCWTAFSVIYTVLSMFKVLDVLEGETVSHSRYIYLAYVFGNLIFALSIIFHIM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITIH1 Rabbit Polyclonal Antibody (RBITC)
orb1040999 100 µL

ITIH1 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
NDST2 Rabbit pAb, Pacific Blue conjugated
orb2878553 100 µL

NDST2 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Agar Strip - MA (MacConkey-Agar for
PS081-10ST 1 unit

Agar Strip - MA (MacConkey-Agar for

Sign In for Pricing
View Details
SH3GL3 (NM_003027) Human Over-expression Lysate
E45H06477-2 20 µg

SH3GL3 (NM_003027) Human Over-expression Lysate

Sign In for Pricing
View Details
Erythronic acid
T78580-01 25 mg

Erythronic acid

Sign In for Pricing
View Details
Erythronic acid
T78580-02 50 mg

Erythronic acid

Sign In for Pricing
View Details