Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

Q2FZV3

Expression Region

1-113

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Poli Mouse shRNA Plasmid (Locus ID 26447)
TR502616 1 Kit

Poli Mouse shRNA Plasmid (Locus ID 26447)

Sign In for Pricing
View Details
Recombinant COVID-19 S Protein RBD
CRP3094-01 50 µg

Recombinant COVID-19 S Protein RBD

Sign In for Pricing
View Details
Recombinant COVID-19 S Protein RBD
CRP3094-02 500 µg

Recombinant COVID-19 S Protein RBD

Sign In for Pricing
View Details
Anti-PDE4A Antibody (Biotin)
STJ502280 100 µg

Anti-PDE4A Antibody (Biotin)

Sign In for Pricing
View Details
HOXC11 Polyclonal Antibody
E-AB-19468-01 20 µL

HOXC11 Polyclonal Antibody

Sign In for Pricing
View Details
HOXC11 Polyclonal Antibody
E-AB-19468-02 60 µL

HOXC11 Polyclonal Antibody

Sign In for Pricing
View Details