Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

Q2FZV3

Expression Region

1-113

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC39A9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
44191111 3x 1.0 µg

SLC39A9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
GAD2 (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kD), GAD65, MGC161605, MGC161607) (MaxLight 490)
246443-ML490 100 µL

GAD2 (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kD), GAD65, MGC161605, MGC161607) (MaxLight 490)

Sign In for Pricing
View Details
ATRX Antibody - C-terminal region : HRP (ARP47775_P050-HRP)
ARP47775_P050-HRP 100 µL

ATRX Antibody - C-terminal region : HRP (ARP47775_P050-HRP)

Sign In for Pricing
View Details
NGF (NM_002506) Human Recombinant Protein
TP321463L 1 mg

NGF (NM_002506) Human Recombinant Protein

Sign In for Pricing
View Details
HTR3A Protein Vector (Rat) (pPM-C-His)
PV273769 500 ng

HTR3A Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
NTNG2 rabbit pAb
UB-GEN-9515 100 µL

NTNG2 rabbit pAb

Sign In for Pricing
View Details