Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

Q2FZV3

Expression Region

1-113

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-IKBKB-3xFLAG-Neo Plasmid
PVT68948 2 µg

PCMV-IKBKB-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
DAL1/EPB41L3 Polyclonal Antibody
bs-6003R 100 µL

DAL1/EPB41L3 Polyclonal Antibody

Sign In for Pricing
View Details
YPEL3 AAV Vector (Human) (CMV)
50626102 1 µg

YPEL3 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
MBP (84-97)
SB181 1

MBP (84-97)

Sign In for Pricing
View Details
XDH Chemi-Luminescent ELISA Kit (Mouse)
OKCD04063-96W 96 Well

XDH Chemi-Luminescent ELISA Kit (Mouse)

Sign In for Pricing
View Details
Human PYDC2 Protein Lysate
MBS8418124-01 0.02 mg

Human PYDC2 Protein Lysate

Sign In for Pricing
View Details