Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sodalis glossinidius Protein AaeX (aaeX)

This Recombinant Sodalis glossinidius Protein AaeX (aaeX) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q2NWN7

Expression Region

1-113

Origin

Sodalis glossinidius (strain morsitans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPVLFEMILSLALFFALRRFLLPSGIYDFVWHPALFNTALYCCVFY LISCHSGADCRYRYFPCLVLLYRIALDAGRQIHRRCGGHCAGRQRPAQRRAYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Lipin 3 Antibody (OTI1D7) [Alexa Fluor 750]
NBP2-72160AF750 0.1 mL

Mouse Monoclonal Lipin 3 Antibody (OTI1D7) [Alexa Fluor 750]

Sign In for Pricing
View Details
Hoxb3 ORF Vector (Rat) (pORF)
23819016 1.0 µg DNA

Hoxb3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
ACADL sgRNA CRISPR Lentivector (Human) (Target 1)
K0026002 1.0 µg DNA

ACADL sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
TNFAIP1 Antibody
orb519618-01 50 μL

TNFAIP1 Antibody

Sign In for Pricing
View Details
TNFAIP1 Antibody
orb519618-02 100 µL

TNFAIP1 Antibody

Sign In for Pricing
View Details
Anti-CCR1 Antibody Picoband® (Dylight594 Conjugate)
A01896-1-Dylight594 100 µg

Anti-CCR1 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details