Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

Q2YWT6

Expression Region

1-113

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Palbociclib Hemisuccinate Ester
TRC-P465350-500MG 500 mg

Palbociclib Hemisuccinate Ester

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2590), Biotin conjugate, 0.1mg/mL
BNCB2590-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2590), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
XRCC3 (NM_001100119) Human Over-expression Lysate
LY420224 100 µg

XRCC3 (NM_001100119) Human Over-expression Lysate

Sign In for Pricing
View Details
GPR 150 (GPR150) Rabbit Polyclonal Antibody
AP01258PU-N 100 µg

GPR 150 (GPR150) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human GALP activation kit by CRISPRa
GA113914 1 Kit

Human GALP activation kit by CRISPRa

Sign In for Pricing
View Details
AR Rabbit Monoclonal Antibody [Clone ID: 23GB2975]
TA424505 100 µL

AR Rabbit Monoclonal Antibody [Clone ID: 23GB2975]

Sign In for Pricing
View Details