Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

Q2YWT6

Expression Region

1-113

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Salinomycin, 20-deoxy-20-oxo
TRC-S145270-10MG 10 mg

Salinomycin, 20-deoxy-20-oxo

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR566323 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
CCN2 Human Gene Knockout Kit (CRISPR)
KN210336 1 Kit

CCN2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Palovarotene
TRC-P165900-10MG 10 mg

Palovarotene

Sign In for Pricing
View Details
LIMD1 Human Gene Knockout Kit (CRISPR)
KN422723 1 Kit

LIMD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Btaf1 Mouse Gene Knockout Kit (CRISPR)
KN502291 1 Kit

Btaf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details