Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma genitalium Uncharacterized protein MG406 (MG406)

This Recombinant Mycoplasma genitalium Uncharacterized protein MG406 (MG406) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Uncharacterized protein MG406

UniProt

Q49431

Expression Region

1-113

Origin

Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLPFAVLNSLSVLRLASFFASLKNVKKQKAVSFFAFFFTARYLIYLIPVIISFVVTPS IFNTIATIISTLFFPILNLVLSFVWLPLEYFFINLISKSKRKHVATGDSFKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Colon: right
CR561593 5 µg

Tissue Total RNA, Colon: right

Sign In for Pricing
View Details
Bexmarilimab Biosimilar - Research Grade
ICH5087-50mg 50 mg

Bexmarilimab Biosimilar - Research Grade

Sign In for Pricing
View Details
Rb (RB1) Rabbit Monoclonal Antibody [Clone ID: R05-2I-6]
TA421540 100 µL

Rb (RB1) Rabbit Monoclonal Antibody [Clone ID: R05-2I-6]

Sign In for Pricing
View Details
TRITC Conjugated Goat Affinity Purified Antibody to Rat IgG
RAF-461-1 1 mL

TRITC Conjugated Goat Affinity Purified Antibody to Rat IgG

Sign In for Pricing
View Details
Promazine-d6 Hydrochloride
TRC-P756302-1MG 1 mg

Promazine-d6 Hydrochloride

Sign In for Pricing
View Details
Cytokeratin 19 (Ks19.1), Biotin conjugate, 0.1mg/mL
BNCB0394-100 1x 100 µL

Cytokeratin 19 (Ks19.1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details