Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

Q6GAX6

Expression Region

1-113

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP1 (Colorectal Cancer Biomarker / Marker of Lymph Node Metastasis) (rTIMP1/1710), Biotin conjugate, 0.1mg/mL
BNCB1943-500 1x 500 µL

TIMP1 (Colorectal Cancer Biomarker / Marker of Lymph Node Metastasis) (rTIMP1/1710), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-100 1x 100 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) Rabbit Polyclonal Antibody
AP20358PU-N 100 µg

Cytokeratin 18 (KRT18) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant MEK2 Antibody
RC-15476-01 50 μL

Recombinant MEK2 Antibody

Sign In for Pricing
View Details
Recombinant MEK2 Antibody
RC-15476-02 100 µL

Recombinant MEK2 Antibody

Sign In for Pricing
View Details
Recombinant MEK2 Antibody
RC-15476-03 1 mL

Recombinant MEK2 Antibody

Sign In for Pricing
View Details