Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

Q6GAX6

Expression Region

1-113

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSI1 Human Gene Knockout Kit (CRISPR)
KN415992 1 Kit

MSI1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ccdc153 Mouse Gene Knockout Kit (CRISPR)
KN502671 1 Kit

Ccdc153 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD32B (FCGR2B) (NM_001002274) Human Over-expression Lysate
LY424201 100 µg

CD32B (FCGR2B) (NM_001002274) Human Over-expression Lysate

Sign In for Pricing
View Details
Hepes
TRC-H998468-2.5G 2.5 g

Hepes

Sign In for Pricing
View Details
SOCS3 Human Gene Knockout Kit (CRISPR)
KN209305BN 1 Kit

SOCS3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Smoothened (SMO) (Center) Rabbit Polyclonal Antibody
AP53947PU-N 400 µL

Smoothened (SMO) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details