Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Araneus ventricosus Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1)

This Recombinant Araneus ventricosus Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1, Oligosaccharyl transferase subunit DAD1, EC= 2.4.1.119, Defender against apoptotic cell death 1, Defender

UniProt

Q8I7Z2

Expression Region

1-113

Origin

Araneus ventricosus (Orbweaver spider) (Epeira ventricosa)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSSAFEVLTFFLKDYKANTPQKLKIIDAYLLYILLTGINQFLYCCLVGTFPFNSFLSGF ISCVASFVLGVCLRLQVNPQNSSNFCGIPPERAFADFIFAHVVLHLVVMNFIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant GFAP Antibody
RC-4393-01 50 μL

Recombinant GFAP Antibody

Sign In for Pricing
View Details
Recombinant GFAP Antibody
RC-4393-02 100 µL

Recombinant GFAP Antibody

Sign In for Pricing
View Details
Recombinant GFAP Antibody
RC-4393-03 1 mL

Recombinant GFAP Antibody

Sign In for Pricing
View Details
Mouse Dnmt3a activation kit by CRISPRa
GA201109 1 Kit

Mouse Dnmt3a activation kit by CRISPRa

Sign In for Pricing
View Details
2'-Acetylneriifolin
TRC-A187010-25MG 25 mg

2'-Acetylneriifolin

Sign In for Pricing
View Details
CSP (DNAJC5) (NM_025219) Human Recombinant Protein
TP308826L 1 mg

CSP (DNAJC5) (NM_025219) Human Recombinant Protein

Sign In for Pricing
View Details