Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF6 (ORF6)

This Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF6 (ORF6) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Uncharacterized protein ORF6, Gene 6 protein

UniProt

P15897

Expression Region

1-113

Origin

Spiroplasma virus SpV1-R8A2 B (SpV1) (Spiroplasma virus 1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMKFWTTKEYKKIKRDFIIRNFAFGFCYFLFLISFIMCIVCFIISINFEVEIILVILFP FLLLILSVWNLFDLIMEHISEIKRFKVTVLKKQIEELEGKMLRGLRVGVDKIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-100 1x 100 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-100 1x 100 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
BNC401081-500 1x 500 µL

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (MLP/842), CF568 conjugate, 0.1mg/mL
BNC680842-100 1x 100 µL

MUC2 (MLP/842), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (GFR450), CF405S conjugate, 0.1mg/mL
BNC040450-100 1x 100 µL

EGFR (GFR450), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details