Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinobacillus succinogenes Fumarate reductase subunit D (frdD)

This Recombinant Actinobacillus succinogenes Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D

UniProt

A6VQC0

Expression Region

1-114

Origin

Actinobacillus succinogenes (strain ATCC 55618 / 130Z)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINTNPKRSNEPPVWLLFSAGGMISALAFPVLILILGILLPLGIISPDGIIAFAHHWFGK LVILVLTIFPAWAGLHRIHHGMHDIKVHVPSGGLIFYGLAVLYTVVAIWGVASI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-500 1x 500 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-100 1x 100 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF488A conjugate, 0.1mg/mL
BNC882497-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (C-04), CF640R conjugate, 0.1mg/mL
BNC400041-100 1x 100 µL

Cytokeratin 18 (C-04), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), CF647 conjugate, 0.1mg/mL
BNC472900-100 1x 100 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details