Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

A7WZ78

Expression Region

1-114

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAIP2B Adenovirus (Human)
35957051 1.0 mL

PAIP2B Adenovirus (Human)

Sign In for Pricing
View Details
Lentiviral mouse Lrrc75b shRNA (UAS) - Lentiviral mouse Lrrc75b shRNA (UAS, GFP) (100)
GTR15215865 1 Vial

Lentiviral mouse Lrrc75b shRNA (UAS) - Lentiviral mouse Lrrc75b shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Lentiviral human MAST2 sgRNA gene knockout kit - Lentiviral human MAST2 sgRNA gene knockout kit (25)
GTR15392508 1 Vial

Lentiviral human MAST2 sgRNA gene knockout kit - Lentiviral human MAST2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Lentiviral mouse Lce3f shRNA (UAS) - Lentiviral mouse Lce3f shRNA (UAS, RFP) plasmid
GTR15296068 1 Vial

Lentiviral mouse Lce3f shRNA (UAS) - Lentiviral mouse Lce3f shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
CLCN4 Blocking Peptide
abx062434-01 1 mg

CLCN4 Blocking Peptide

Sign In for Pricing
View Details
CLCN4 Blocking Peptide
abx062434-02 5 mg

CLCN4 Blocking Peptide

Sign In for Pricing
View Details