Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis UPF0092 membrane protein CT_741 (CT_741)

This Recombinant Chlamydia trachomatis UPF0092 membrane protein CT_741 (CT_741) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

UPF0092 membrane protein CT_741

UniProt

O84746

Expression Region

1-114

Origin

Chlamydia trachomatis (strain D/UW-3/Cx)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSRLFFSILFFLGCCPALFADTDSPQRATFGQPAVMLGIAIVFFYFILWRPEQKRRQAM EKRKSELAVGDKVTAMGIVGTIAEIREHTVILNIASGKIEILKAAISEILKAEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-500 1x 500 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-100 1x 100 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (rBP53-12), CF594 conjugate, 0.1mg/mL
BNC942094-500 1x 500 µL

P53 Tumor Suppressor Protein (rBP53-12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1870), CF647 conjugate, 0.1mg/mL
BNC471870-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1870), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details