Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hordeum vulgare Defender against cell death 1 (DAD1)

This Recombinant Hordeum vulgare Defender against cell death 1 (DAD1) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Defender against cell death 1, DAD-1

UniProt

Q9SME9

Expression Region

1-114

Origin

Hordeum vulgare (Barley)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKAAGDAKLLIQSLNKAYAATPTNLKIIDLYVVFAVVTALLQVVYMGIVGSFPFNSFLS GVLSCIGTAVLAVCHRIQVNKDNKEFKDLAPERAFADFVLCSLVLHLVIMNFLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-500 1x 500 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL
BNC680003-500 1x 500 µL

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF405S conjugate, 0.1mg/mL
BNC041919-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-100 1x 100 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF640R conjugate, 0.1mg/mL
BNC401118-100 1x 100 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (100/D5), CF647 conjugate, 0.1mg/mL
BNC470045-500 1x 500 µL

Bcl-2 (100/D5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details