Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q2G213

Expression Region

1-114

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTMR11 3'UTR Lenti-reporter-Luc Vector
30905081 1.0 µg

MTMR11 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
ACTG1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0035808 1.0 µg DNA

ACTG1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
GRHL3 Rabbit Polyclonal Antibody
orb1880304-01 30 µL

GRHL3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GRHL3 Rabbit Polyclonal Antibody
orb1880304-02 50 µL

GRHL3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GRHL3 Rabbit Polyclonal Antibody
orb1880304-03 100 µL

GRHL3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GRHL3 Rabbit Polyclonal Antibody
orb1880304-04 200 µL

GRHL3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details