Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine PDZK1-interacting protein 1 (PDZK1IP1)

This Recombinant Bovine PDZK1-interacting protein 1 (PDZK1IP1) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

PDZK1-interacting protein 1

UniProt

Q2KIP5

Expression Region

1-114

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVLSLVVLSLLMALPPASCQQGRGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEKPA PINMVMTIGNKADGILVGTDGKYSSMAASFRSSEHENAYENIPEEEGKVCSTPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-500 1x 500 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (rMX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC882562-500 1x 500 µL

CD63 (Late Endosomes Marker) (rMX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (31G7), CF594 conjugate, 0.1mg/mL
BNC941194-500 1x 500 µL

EGFR (31G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II, Mouse (MK-D6), CF405S conjugate, 0.1mg/mL
BNC042007-500 1x 500 µL

MHC II, Mouse (MK-D6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details