Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q2YSV5

Expression Region

1-114

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 Spike RBD (P521R) (His Tag)
PKSV030455 100 µg

Recombinant SARS-CoV-2 Spike RBD (P521R) (His Tag)

Sign In for Pricing
View Details
O-t-Butyldiphenylsilylhydroxylamine
TRC-B820030-500MG 500 mg

O-t-Butyldiphenylsilylhydroxylamine

Sign In for Pricing
View Details
(9Z)-9-Octadecen-1-ol, 85%
TRC-O235935-10G 10 g

(9Z)-9-Octadecen-1-ol, 85%

Sign In for Pricing
View Details
Xpc Mouse Gene Knockout Kit (CRISPR)
KN519509 1 Kit

Xpc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Slc26a2 activation kit by CRISPRa
GA201142 1 Kit

Mouse Slc26a2 activation kit by CRISPRa

Sign In for Pricing
View Details
2-O-(p-Nitrophenyl)-Alpha-D-N-acetylneuraminic Acid, Sodium Salt, X Hydrate
TRC-N502501-10MG 10 mg

2-O-(p-Nitrophenyl)-Alpha-D-N-acetylneuraminic Acid, Sodium Salt, X Hydrate

Sign In for Pricing
View Details