Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q5HRB0

Expression Region

1-114

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGKYGPHMSEPLIQG HAQNFVDPLLQAIVLTAIVIGFGMTAFLLVLIYRTYRVTKEDEISALKGDEDDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IQCA1L activation kit by CRISPRa
GA118236 1 Kit

Human IQCA1L activation kit by CRISPRa

Sign In for Pricing
View Details
VCAM1 (NM_001078) Human Over-expression Lysate
LY421491 100 µg

VCAM1 (NM_001078) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Acp2 activation kit by CRISPRa
GA200028 1 Kit

Mouse Acp2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant MAD2L2 Antibody
RC-6992-01 50 μL

Recombinant MAD2L2 Antibody

Sign In for Pricing
View Details
Recombinant MAD2L2 Antibody
RC-6992-02 100 µL

Recombinant MAD2L2 Antibody

Sign In for Pricing
View Details
Recombinant MAD2L2 Antibody
RC-6992-03 1 mL

Recombinant MAD2L2 Antibody

Sign In for Pricing
View Details