Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q5HRB0

Expression Region

1-114

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGKYGPHMSEPLIQG HAQNFVDPLLQAIVLTAIVIGFGMTAFLLVLIYRTYRVTKEDEISALKGDEDDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il2ra Rat Monoclonal Antibody [Clone ID: 7D4]
AM08035RP-S 100 µg

Il2ra Rat Monoclonal Antibody [Clone ID: 7D4]

Sign In for Pricing
View Details
BACE1 Rabbit Polyclonal Antibody
AP06371PU-N 100 µg

BACE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat CTXI (Cross Linked C-telopeptide of Type I Collagen) ELISA Kit
E-EL-R1456-01 24 Tests

Rat CTXI (Cross Linked C-telopeptide of Type I Collagen) ELISA Kit

Sign In for Pricing
View Details
Rat CTXI (Cross Linked C-telopeptide of Type I Collagen) ELISA Kit
E-EL-R1456-02 48 Tests

Rat CTXI (Cross Linked C-telopeptide of Type I Collagen) ELISA Kit

Sign In for Pricing
View Details
Rat CTXI (Cross Linked C-telopeptide of Type I Collagen) ELISA Kit
E-EL-R1456-03 96 Tests

Rat CTXI (Cross Linked C-telopeptide of Type I Collagen) ELISA Kit

Sign In for Pricing
View Details
TAF12 Human Gene Knockout Kit (CRISPR)
KN402055 1 Kit

TAF12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details