Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q5HRB0

Expression Region

1-114

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGKYGPHMSEPLIQG HAQNFVDPLLQAIVLTAIVIGFGMTAFLLVLIYRTYRVTKEDEISALKGDEDDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD56 Antibody[B-A19]
E-AB-F1305A-01 25 µg

Purified Anti-Human CD56 Antibody[B-A19]

Sign In for Pricing
View Details
Purified Anti-Human CD56 Antibody[B-A19]
E-AB-F1305A-02 100 µg

Purified Anti-Human CD56 Antibody[B-A19]

Sign In for Pricing
View Details
D4Ertd196e (BC037609) Mouse Tagged ORF Clone
MG201786 10 µg

D4Ertd196e (BC037609) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
E2F1 Rabbit Polyclonal Antibody
TA371678 100 µL

E2F1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Phenylfuran
TRC-P321930-5MG 5 mg

2-Phenylfuran

Sign In for Pricing
View Details
MIR941-3 Human qPCR Primer Pair (MI0005765)
HP300680 200 Reactions

MIR941-3 Human qPCR Primer Pair (MI0005765)

Sign In for Pricing
View Details