Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L682 (MIMI_L682)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L682 (MIMI_L682) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Uncharacterized protein L682

UniProt

Q5UNU7

Expression Region

1-114

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNYISFKKEFGLILVGAIIFTASYLWKDLLLEIEEKYFPKGYGLMWRSIYTILVTVILV LVAIHLKNQFGLVNKDSKDPKDKSIEFDDSPIRDGSSGTPDNSNEPTDLSVETS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MAP2 Antibody (pS1539)
F48609-0.4ML 0.4 mL

Phospho-MAP2 Antibody (pS1539)

Sign In for Pricing
View Details
3',5'-Di-O-acetyl-2'-deoxy-2'-fluorouridine
TRC-D422508-50MG 50 mg

3',5'-Di-O-acetyl-2'-deoxy-2'-fluorouridine

Sign In for Pricing
View Details
LRRC47 Antibody
KC-41830-01 50 μL

LRRC47 Antibody

Sign In for Pricing
View Details
LRRC47 Antibody
KC-41830-02 100 µL

LRRC47 Antibody

Sign In for Pricing
View Details
LRRC47 Antibody
KC-41830-03 1 mL

LRRC47 Antibody

Sign In for Pricing
View Details
Human APCDD1L activation kit by CRISPRa
GA116109 1 Kit

Human APCDD1L activation kit by CRISPRa

Sign In for Pricing
View Details