Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L682 (MIMI_L682)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L682 (MIMI_L682) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Uncharacterized protein L682

UniProt

Q5UNU7

Expression Region

1-114

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNYISFKKEFGLILVGAIIFTASYLWKDLLLEIEEKYFPKGYGLMWRSIYTILVTVILV LVAIHLKNQFGLVNKDSKDPKDKSIEFDDSPIRDGSSGTPDNSNEPTDLSVETS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vps54 Mouse Gene Knockout Kit (CRISPR)
KN519267 1 Kit

Vps54 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pdcd1 (NM_008798) Mouse Recombinant Protein
TP700257 20 µg

Pdcd1 (NM_008798) Mouse Recombinant Protein

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (rBP53-12), CF740 conjugate, 0.1mg/mL
BNC742094-500 1x 500 µL

P53 Tumor Suppressor Protein (rBP53-12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DR5 (TNFRSF10B) Human Gene Knockout Kit (CRISPR)
KN201588BN 1 Kit

DR5 (TNFRSF10B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
E-AB-F1028UG-01 25 µg

PE/Cyanine5 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
E-AB-F1028UG-02 100 µg

PE/Cyanine5 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]

Sign In for Pricing
View Details