Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L682 (MIMI_L682)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L682 (MIMI_L682) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Uncharacterized protein L682

UniProt

Q5UNU7

Expression Region

1-114

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNYISFKKEFGLILVGAIIFTASYLWKDLLLEIEEKYFPKGYGLMWRSIYTILVTVILV LVAIHLKNQFGLVNKDSKDPKDKSIEFDDSPIRDGSSGTPDNSNEPTDLSVETS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fatty Acid Synthase (FASN) activation kit by CRISPRa
GA101533 1 Kit

Human Fatty Acid Synthase (FASN) activation kit by CRISPRa

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF568 conjugate, 0.1mg/mL
BNC680810-100 1x 100 µL

AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COL4A3 Rabbit polyclonal Antibody
HA500591 100 µL

COL4A3 Rabbit polyclonal Antibody

Sign In for Pricing
View Details
Zerumbone
SIH-265-50MG 50 mg

Zerumbone

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2990R), CF405S conjugate, 0.1mg/mL
BNC042990-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2990R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZRANB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A10]
TA810024AM 100 µL

ZRANB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A10]

Sign In for Pricing
View Details