Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q6GJ45

Expression Region

1-114

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSNKSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TRIM11 antibody
PAab08967 100 µg

Anti-TRIM11 antibody

Sign In for Pricing
View Details
Goat anti-BOD1 Antibody
dAP-2033 50 µg

Goat anti-BOD1 Antibody

Sign In for Pricing
View Details
Slc29a3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7211406 1.0 µg DNA

Slc29a3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Human IGF-I Recombinant Protein
CST 29608S 20 µg

Human IGF-I Recombinant Protein

Sign In for Pricing
View Details
Msln Mouse shRNA Plasmid (Locus ID 56047)
TL511558 1 Kit

Msln Mouse shRNA Plasmid (Locus ID 56047)

Sign In for Pricing
View Details
Human USP2 (NM_004205) AAV Particle
RC200273A1V 250 µL

Human USP2 (NM_004205) AAV Particle

Sign In for Pricing
View Details