Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q7A1N0

Expression Region

1-114

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TLK2 shRNA (UAS) - Lentiviral human TLK2 shRNA (UAS, RFP) (100)
GTR15093960 1 Vial

Lentiviral human TLK2 shRNA (UAS) - Lentiviral human TLK2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
1,2-O-Dihexadecyl-sn-glycerol
sc-287223A 1 g

1,2-O-Dihexadecyl-sn-glycerol

Sign In for Pricing
View Details
SLC25A46 Antibody, FITC conjugated
MBS1499054-01 0.05 mg

SLC25A46 Antibody, FITC conjugated

Sign In for Pricing
View Details
SLC25A46 Antibody, FITC conjugated
MBS1499054-02 0.1 mg

SLC25A46 Antibody, FITC conjugated

Sign In for Pricing
View Details
SLC25A46 Antibody, FITC conjugated
MBS1499054-03 5x 0.1 mg

SLC25A46 Antibody, FITC conjugated

Sign In for Pricing
View Details
STAT3 (Phospho Ser727) Rabbit mAb
E60M0792 100 µL

STAT3 (Phospho Ser727) Rabbit mAb

Sign In for Pricing
View Details