Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q7A726

Expression Region

1-114

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APLP1 Human Over-expression Lysate
orb1377981 20 µg

APLP1 Human Over-expression Lysate

Sign In for Pricing
View Details
Cytochrome c Blocking Peptide
MBS8248018-01 1 mg

Cytochrome c Blocking Peptide

Sign In for Pricing
View Details
Cytochrome c Blocking Peptide
MBS8248018-02 5 mg

Cytochrome c Blocking Peptide

Sign In for Pricing
View Details
Cytochrome c Blocking Peptide
MBS8248018-03 5x 5 mg

Cytochrome c Blocking Peptide

Sign In for Pricing
View Details
TAP2 Antibody
E91610 100 µL

TAP2 Antibody

Sign In for Pricing
View Details
S-a-Benzylproline·HCl
265658-01 50 mg

S-a-Benzylproline·HCl

Sign In for Pricing
View Details