Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q7A726

Expression Region

1-114

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNB2 Antibody
CSB-PA009604ESR2HU-01 50 μL

GNB2 Antibody

Sign In for Pricing
View Details
GNB2 Antibody
CSB-PA009604ESR2HU-02 100 µL

GNB2 Antibody

Sign In for Pricing
View Details
ZNF239 Rabbit Polyclonal Antibody (Cy7)
orb1056828 100 µL

ZNF239 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Recombinant Frankia sp. Peptide chain release factor 1 (prfA)
MBS1427813-01 0.02 mg (E-Coli)

Recombinant Frankia sp. Peptide chain release factor 1 (prfA)

Sign In for Pricing
View Details
Recombinant Frankia sp. Peptide chain release factor 1 (prfA)
MBS1427813-02 0.02 mg (Yeast)

Recombinant Frankia sp. Peptide chain release factor 1 (prfA)

Sign In for Pricing
View Details
Recombinant Frankia sp. Peptide chain release factor 1 (prfA)
MBS1427813-03 0.1 mg (E-Coli)

Recombinant Frankia sp. Peptide chain release factor 1 (prfA)

Sign In for Pricing
View Details