Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat PDZK1-interacting protein 1 (Pdzk1ip1)

This Recombinant Rat PDZK1-interacting protein 1 (Pdzk1ip1) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

PDZK1-interacting protein 1, 17 kDa membrane-associated protein

UniProt

Q923S2

Expression Region

1-114

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLALSLLALGLLAEVAPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEQE PGSTMMITGNKADGVLVGMDGRYSSMASGFRSSEHKNAFENVLEEEGRVRSTPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD137, Mouse (LOB12), CF740 conjugate, 0.1mg/mL
BNC742012-500 1x 500 µL

CD137, Mouse (LOB12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UPK3A (Uroplakin 3A) (Rabbit PAb), CF405S conjugate, 0.1mg/mL
BNC040409-100 1x 100 µL

UPK3A (Uroplakin 3A) (Rabbit PAb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details