Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q99VZ0

Expression Region

1-114

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEN1/2 (A79) polyclonal antibody
BS2031-01 50 µL

HEN1/2 (A79) polyclonal antibody

Sign In for Pricing
View Details
HEN1/2 (A79) polyclonal antibody
BS2031-02 100 µL

HEN1/2 (A79) polyclonal antibody

Sign In for Pricing
View Details
ZSCAN30 AAV siRNA Pooled Vector
51970161 1.0 µg

ZSCAN30 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
FSD1L Rabbit Polyclonal Antibody
orb326353 100 µL

FSD1L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human GPRC5A shRNA (UAS) - Lentiviral human GPRC5A shRNA (UAS, GFP) (100)
GTR15348204 1 Vial

Lentiviral human GPRC5A shRNA (UAS) - Lentiviral human GPRC5A shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal COX4 Antibody [Janelia Fluor 646]
NB110-39115JF646 0.1 mL

Rabbit Polyclonal COX4 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details