Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse PDZK1-interacting protein 1 (Pdzk1ip1)

This Recombinant Mouse PDZK1-interacting protein 1 (Pdzk1ip1) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

PDZK1-interacting protein 1, 17 kDa membrane-associated protein

UniProt

Q9CQH0

Expression Region

1-114

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAFSLLVLGLLAEVAPASCQQGLGNLQPWMQGLIAVAVFLVLVAIVFAVNHFWCQEEPE PGSTVMIIGNKADGVLVGMDGRYSSMASGFRSSEHKNAYENVLEEEGRVRSTPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ado Mouse Gene Knockout Kit (CRISPR)
KN500917 1 Kit

Ado Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DLX4 Human Gene Knockout Kit (CRISPR)
KN402187 1 Kit

DLX4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FLT3 (Ab-599) Antibody
8B0482-AAT 50 µg

FLT3 (Ab-599) Antibody

Sign In for Pricing
View Details
FCRLA Polyclonal Antibody
E-AB-53172-01 20 µL

FCRLA Polyclonal Antibody

Sign In for Pricing
View Details
FCRLA Polyclonal Antibody
E-AB-53172-02 60 µL

FCRLA Polyclonal Antibody

Sign In for Pricing
View Details
FCRLA Polyclonal Antibody
E-AB-53172-03 120 µL

FCRLA Polyclonal Antibody

Sign In for Pricing
View Details