Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse PDZK1-interacting protein 1 (Pdzk1ip1)

This Recombinant Mouse PDZK1-interacting protein 1 (Pdzk1ip1) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

PDZK1-interacting protein 1, 17 kDa membrane-associated protein

UniProt

Q9CQH0

Expression Region

1-114

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAFSLLVLGLLAEVAPASCQQGLGNLQPWMQGLIAVAVFLVLVAIVFAVNHFWCQEEPE PGSTVMIIGNKADGVLVGMDGRYSSMASGFRSSEHKNAYENVLEEEGRVRSTPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Hemopexin Antibody
RC-15662-01 50 μL

Recombinant Hemopexin Antibody

Sign In for Pricing
View Details
Recombinant Hemopexin Antibody
RC-15662-02 100 µL

Recombinant Hemopexin Antibody

Sign In for Pricing
View Details
Recombinant Hemopexin Antibody
RC-15662-03 1 mL

Recombinant Hemopexin Antibody

Sign In for Pricing
View Details
Isopentyl Mesylate
TRC-I821885-500MG 500 mg

Isopentyl Mesylate

Sign In for Pricing
View Details
DUSP10 (N-term) Rabbit Polyclonal Antibody
AP15272PU-N 400 µL

DUSP10 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Motorize Pipette Controller BPIP-411
BPIP-411 1 Unit

Motorize Pipette Controller BPIP-411

Sign In for Pricing
View Details