Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse PDZK1-interacting protein 1 (Pdzk1ip1)

This Recombinant Mouse PDZK1-interacting protein 1 (Pdzk1ip1) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

PDZK1-interacting protein 1, 17 kDa membrane-associated protein

UniProt

Q9CQH0

Expression Region

1-114

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAFSLLVLGLLAEVAPASCQQGLGNLQPWMQGLIAVAVFLVLVAIVFAVNHFWCQEEPE PGSTVMIIGNKADGVLVGMDGRYSSMASGFRSSEHKNAYENVLEEEGRVRSTPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD1, Mouse (RMP1-14), CF405S conjugate, 0.1mg/mL
BNC042002-500 1x 500 µL

PD1, Mouse (RMP1-14), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Clpb Mouse Gene Knockout Kit (CRISPR)
KN503483 1 Kit

Clpb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biglycan Recombinant Rabbit Monoclonal Antibody [JB71-31]
ET7107-48 100 µL

Biglycan Recombinant Rabbit Monoclonal Antibody [JB71-31]

Sign In for Pricing
View Details
Mucin 6 (MUC6) (CLH5), CF640R conjugate, 0.1mg/mL
BNC400891-100 1x 100 µL

Mucin 6 (MUC6) (CLH5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
YOD1 antibody
FNab09567 100 µg

YOD1 antibody

Sign In for Pricing
View Details
Btbd10 Mouse Gene Knockout Kit (CRISPR)
KN502293 1 Kit

Btbd10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details