Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 207 (Tmem207)

This Recombinant Mouse Transmembrane protein 207 (Tmem207) spans the amino acid sequence from region 30-143.

Product Specifications

Product Name Alternative

Transmembrane protein 207

UniProt

P86045

Expression Region

30-143

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DLSCEENEMCVNYDERYPDGWYIWFFLLIFLVVLLCGVVLFCLQCWLKRCGINPPRRTMA VFAVGDLDPVYGAEMAGSPTSGICHPTQNTELCSAPCFGALGPPPPYEEILKAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CK18 Antibody / Cytokeratin 18
orb2638776 7 mL

CK18 Antibody / Cytokeratin 18

Sign In for Pricing
View Details
PGRP-S (G-1) : m-IgG Fc BP-HRP Bundle
sc-527351 1 Kit

PGRP-S (G-1) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
METAP1D Rabbit Polyclonal Antibody (APC)
orb2585990 100 µg

METAP1D Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
LOG5 Antibody
orb791844 2 mg

LOG5 Antibody

Sign In for Pricing
View Details
Mouse Tryptophan Hydroxylase 1 (TPH1) ELISA Kit
MBS4503059-01 48 Tests

Mouse Tryptophan Hydroxylase 1 (TPH1) ELISA Kit

Sign In for Pricing
View Details
Mouse Tryptophan Hydroxylase 1 (TPH1) ELISA Kit
MBS4503059-02 96 Tests

Mouse Tryptophan Hydroxylase 1 (TPH1) ELISA Kit

Sign In for Pricing
View Details