Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 207 (Tmem207)

This Recombinant Mouse Transmembrane protein 207 (Tmem207) spans the amino acid sequence from region 30-143.

Product Specifications

Product Name Alternative

Transmembrane protein 207

UniProt

P86045

Expression Region

30-143

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DLSCEENEMCVNYDERYPDGWYIWFFLLIFLVVLLCGVVLFCLQCWLKRCGINPPRRTMA VFAVGDLDPVYGAEMAGSPTSGICHPTQNTELCSAPCFGALGPPPPYEEILKAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rno-miR-1b miRNA Antagomir
MNR01260 2x 5.0 nmol

rno-miR-1b miRNA Antagomir

Sign In for Pricing
View Details
Sri sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3050704 1.0 µg DNA

Sri sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
IFN-omega, Recombinant, Human (Interferon omega, IFN alpha II-1, IFNW1)
219865-01 20 µg

IFN-omega, Recombinant, Human (Interferon omega, IFN alpha II-1, IFNW1)

Sign In for Pricing
View Details
IFN-omega, Recombinant, Human (Interferon omega, IFN alpha II-1, IFNW1)
219865-02 100 µg

IFN-omega, Recombinant, Human (Interferon omega, IFN alpha II-1, IFNW1)

Sign In for Pricing
View Details
RNA Helicase A/DHX9 Rabbit Polyclonal Antibody (Cy3)
orb2606510 100 µg

RNA Helicase A/DHX9 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Recombinant Methanosphaera stadtmanae Undecaprenyl-diphosphatase (uppP)
orb2907500-01 20 µg

Recombinant Methanosphaera stadtmanae Undecaprenyl-diphosphatase (uppP)

Sign In for Pricing
View Details