Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 207 (Tmem207)

This Recombinant Mouse Transmembrane protein 207 (Tmem207) spans the amino acid sequence from region 30-143.

Product Specifications

Product Name Alternative

Transmembrane protein 207

UniProt

P86045

Expression Region

30-143

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DLSCEENEMCVNYDERYPDGWYIWFFLLIFLVVLLCGVVLFCLQCWLKRCGINPPRRTMA VFAVGDLDPVYGAEMAGSPTSGICHPTQNTELCSAPCFGALGPPPPYEEILKAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal STK11IP Antibody [Alexa Fluor 750]
NBP1-30109AF750 0.1 mL

Rabbit Polyclonal STK11IP Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Goat Carboxy terminal domain RNA polymerase II polypeptide A small phosphatase 2 (CTDSP2) ELISA Kit
GTR10315766 96 Well

Goat Carboxy terminal domain RNA polymerase II polypeptide A small phosphatase 2 (CTDSP2) ELISA Kit

Sign In for Pricing
View Details
DUSP26 Rabbit Polyclonal Antibody (Cy3)
orb981272 100 µL

DUSP26 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Anti-ERK 1/2 antibody
STJ92990 200 µl

Anti-ERK 1/2 antibody

Sign In for Pricing
View Details
KLHL42 Polyclonal Antibody
A59574-100 100 µL

KLHL42 Polyclonal Antibody

Sign In for Pricing
View Details
ATP6V1F Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV694229 1.0 µg DNA

ATP6V1F Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details