Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 207 (Tmem207)

This Recombinant Mouse Transmembrane protein 207 (Tmem207) spans the amino acid sequence from region 30-143.

Product Specifications

Product Name Alternative

Transmembrane protein 207

UniProt

P86045

Expression Region

30-143

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DLSCEENEMCVNYDERYPDGWYIWFFLLIFLVVLLCGVVLFCLQCWLKRCGINPPRRTMA VFAVGDLDPVYGAEMAGSPTSGICHPTQNTELCSAPCFGALGPPPPYEEILKAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-CY5.5 mouse anti-mouse CD45.2/Ly-5.2
E16FME045.2-100U 100 µg

APC-CY5.5 mouse anti-mouse CD45.2/Ly-5.2

Sign In for Pricing
View Details
MAGEA4 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-3645R-BF594 100 µL

MAGEA4 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
3- (4-Hydroxyphenyl) hex-4-ynoic acid
QJB23334 2.5 g

3- (4-Hydroxyphenyl) hex-4-ynoic acid

Sign In for Pricing
View Details
Shank3 AAV siRNA Pooled Vector
43695164 1.0 µg

Shank3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
NETR rabbit pAb
E44H13831 100 µL

NETR rabbit pAb

Sign In for Pricing
View Details
GATA2 (NM_001145661) Human Tagged ORF Clone Lentiviral Particle
RC227363L3V 200 µL

GATA2 (NM_001145661) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details