Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 207 (Tmem207)

This Recombinant Mouse Transmembrane protein 207 (Tmem207) spans the amino acid sequence from region 30-143.

Product Specifications

Product Name Alternative

Transmembrane protein 207

UniProt

P86045

Expression Region

30-143

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DLSCEENEMCVNYDERYPDGWYIWFFLLIFLVVLLCGVVLFCLQCWLKRCGINPPRRTMA VFAVGDLDPVYGAEMAGSPTSGICHPTQNTELCSAPCFGALGPPPPYEEILKAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ASMTL Antibody [DyLight 650]
NBP2-97878C 0.1 mL

Rabbit Polyclonal ASMTL Antibody [DyLight 650]

Sign In for Pricing
View Details
LCE3C Rabbit Polyclonal Antibody (FITC)
orb2091522 100 µL

LCE3C Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Guinea Pig Angiomotin like protein 1 (AMOTL1) ELISA kit
GTR10408390 96 Well

Guinea Pig Angiomotin like protein 1 (AMOTL1) ELISA kit

Sign In for Pricing
View Details
CNIH2 Protein Vector (Mouse) (pPM-C-His)
PV166649 500 ng

CNIH2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
5,5-Bis (bromomethyl) -2-phenyl-1,3-dioxane
437098-01 100 mg

5,5-Bis (bromomethyl) -2-phenyl-1,3-dioxane

Sign In for Pricing
View Details
5,5-Bis (bromomethyl) -2-phenyl-1,3-dioxane
437098-02 250 mg

5,5-Bis (bromomethyl) -2-phenyl-1,3-dioxane

Sign In for Pricing
View Details