Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Reprimo-like protein (rprml)

This Recombinant Danio rerio Reprimo-like protein (rprml) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Reprimo-like protein

UniProt

A5PLA0

Expression Region

1-114

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTFFNHTVFTHGVLLNRSQELAGTLVDCCTGNGSEVTANDGGGSLVLAQDERKLFVTR VVQIAVLCVLSLTVMFGIFFLGCNLMIKSESMINFLVKDRRSSKDVEAVMIGLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-100 1x 100 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdc20 (AR12), CF647 conjugate, 0.1mg/mL
BNC470672-500 1x 500 µL

Cdc20 (AR12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/1506R), CF568 conjugate, 0.1mg/mL
BNC681506-100 1x 100 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/1506R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (8C8), CF740 conjugate, 0.1mg/mL
BNC740005-500 1x 500 µL

Bcl-2 (8C8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF647 conjugate, 0.1mg/mL
BNC472329-100 1x 100 µL

MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details